| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (17 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries) |
| Domain d3vhxc1: 3vhx C:13-173 [217821] Other proteins in same PDB: d3vhxa2, d3vhxc2, d3vhxe2, d3vhxg2 automated match to d1upta_ complexed with gol, gtp, mg |
PDB Entry: 3vhx (more details), 2.81 Å
SCOPe Domain Sequences for d3vhxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vhxc1 c.37.1.8 (C:13-173) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
emrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkirp
lwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkp
heiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
Timeline for d3vhxc1: