![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
![]() | Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries) |
![]() | Domain d3vgba3: 3vgb A:491-557 [217815] Other proteins in same PDB: d3vgba1, d3vgba2 automated match to d1eh9a2 complexed with flc, gol |
PDB Entry: 3vgb (more details), 2.65 Å
SCOPe Domain Sequences for d3vgba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgba3 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]} cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd kgfalyk
Timeline for d3vgba3: