SCOPe 2.06: Domain d3vgba3: 3vgb A:491-557

Lineage for d3vgba3 (3vgb A:491-557)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries)

8. Domain d3vgba3: 3vgb A:491-557 [217815]
   Other proteins in same PDB: d3vgba1, d3vgba2
   automated match to d1eh9a2
   complexed with flc, gol

Details for d3vgba3

PDB Entry: 3vgb, 2.65 Å

PDB Description: Crystal structure of glycosyltrehalose trehalohydrolase (GTHase) from Sulfolobus solfataricus KM1

PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgba3:

Sequence; same for both SEQRES and ATOM records:

>d3vgba3 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

Timeline for d3vgba3:

• d3vgba3 first appeared in SCOPe 2.03
  
• d3vgba3 appears in SCOPe 2.05
  
• d3vgba3 appears in SCOPe 2.07
  
• d3vgba3 appears in the current release, SCOPe 2.08