Lineage for d3vgba3 (3vgb A:491-557)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810593Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)
  7. 2810604Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries)
  8. 2810606Domain d3vgba3: 3vgb A:491-557 [217815]
    Other proteins in same PDB: d3vgba1, d3vgba2
    automated match to d1eh9a2
    complexed with flc, gol

Details for d3vgba3

PDB Entry: 3vgb (more details), 2.65 Å

PDB Description: Crystal structure of glycosyltrehalose trehalohydrolase (GTHase) from Sulfolobus solfataricus KM1
PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgba3 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk

SCOPe Domain Coordinates for d3vgba3:

Click to download the PDB-style file with coordinates for d3vgba3.
(The format of our PDB-style files is described here.)

Timeline for d3vgba3: