SCOPe 2.05: Domain d3vg9b1: 3vg9 B:1-107

Lineage for d3vg9b1 (3vg9 B:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3vg9b1: 3vg9 B:1-107 [217811]
   Other proteins in same PDB: d3vg9b2
   automated match to d1dqdl1
   complexed with lmt, ste, zma

Details for d3vg9b1

PDB Entry: 3vg9, 2.7 Å

PDB Description: Crystal structure of human adenosine A2A receptor with an allosteric inverse-agonist antibody at 2.7 A resolution

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3vg9b1:

Sequence; same for both SEQRES and ATOM records:

>d3vg9b1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleik

Timeline for d3vg9b1:

• d3vg9b1 first appeared in SCOPe 2.03
  
• d3vg9b1 appears in SCOPe 2.04
  
• d3vg9b1 appears in SCOPe 2.06
  
• d3vg9b1 appears in the current release, SCOPe 2.08