Lineage for d2fcba1 (2fcb A:6-90)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364924Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2364930Species Human (Homo sapiens), IIb [TaxId:9606] [49198] (1 PDB entry)
  8. 2364931Domain d2fcba1: 2fcb A:6-90 [21781]

Details for d2fcba1

PDB Entry: 2fcb (more details), 1.74 Å

PDB Description: human fc gamma receptor iib ectodomain (cd32)
PDB Compounds: (A:) protein (fc gamma riib)

SCOPe Domain Sequences for d2fcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]}
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls

SCOPe Domain Coordinates for d2fcba1:

Click to download the PDB-style file with coordinates for d2fcba1.
(The format of our PDB-style files is described here.)

Timeline for d2fcba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fcba2