SCOP 1.63: Domain d2fcba1: 2fcb A:6-90

Lineage for d2fcba1 (2fcb A:6-90)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (27 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), IIb [TaxId:9606] [49198] (1 PDB entry)

8. Domain d2fcba1: 2fcb A:6-90 [21781]

Details for d2fcba1

PDB Entry: 2fcb, 1.74 Å

PDB Description: human fc gamma receptor iib ectodomain (cd32)

SCOP Domain Sequences for d2fcba1:

Sequence; same for both SEQRES and ATOM records:

>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb}
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls

Timeline for d2fcba1:

• d2fcba1 first appeared (with stable ids) in SCOP 1.55
  
• d2fcba1 appears in SCOP 1.61
  
• d2fcba1 appears in SCOP 1.65
  
• d2fcba1 appears in the current release, SCOPe 2.08