Lineage for d2fcba1 (2fcb A:6-90)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) Species Human (Homo sapiens), IIb [TaxId:9606] [49198] (1 PDB entry) 
Domain d2fcba1: 2fcb A:6-90 [21781]
Details for d2fcba1
PDB Entry: 2fcb (more details), 1.74 Å
PDB Description: human fc gamma receptor iib ectodomain (cd32)
SCOP Domain Sequences for d2fcba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb}
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls
SCOP Domain Coordinates for d2fcba1:
Click to download the PDB-style file with coordinates for d2fcba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fcba1:
- d2fcba1 appears in SCOP 1.57
- d2fcba1 appears in the current release, SCOPe 2.08
View in 3D
