Lineage for d2fcba1 (2fcb A:6-90)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), IIb [TaxId:9606] [49198] (1 PDB entry) 
Domain d2fcba1: 2fcb A:6-90 [21781]
Details for d2fcba1
PDB Entry: 2fcb (more details), 1.74 Å
PDB Description: human fc gamma receptor iib ectodomain (cd32)
PDB Compounds: (A:) protein (fc gamma riib)SCOPe Domain Sequences for d2fcba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]}
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvls
SCOPe Domain Coordinates for d2fcba1:
Click to download the PDB-style file with coordinates for d2fcba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fcba1:
- d2fcba1 first appeared (with stable ids) in SCOP 1.55
- d2fcba1 appears in SCOPe 2.07
View in 3D
