SCOPe 2.03: Domain d3vg2a_: 3vg2 A:

Lineage for d3vg2a_ (3vg2 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver fatty acid binding protein [50866] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141464] (15 PDB entries)
   Uniprot P07148 1-127

8. Domain d3vg2a_: 3vg2 A: [217806]
   automated match to d3vg7a_
   complexed with iod, plm

Details for d3vg2a_

PDB Entry: 3vg2, 2.4 Å

PDB Description: Iodide derivative of human LFABP

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d3vg2a_:

Sequence; same for both SEQRES and ATOM records:

>d3vg2a_ b.60.1.2 (A:) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
ssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskrigt

Timeline for d3vg2a_:

• d3vg2a_ is new in SCOPe 2.03-stable
  
• d3vg2a_ appears in SCOPe 2.04
  
• d3vg2a_ appears in the current release, SCOPe 2.08, called d3vg2a1