SCOP 1.57: Domain d1fcga2: 1fcg A:89-174

Lineage for d1fcga2 (1fcg A:89-174)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)

7. Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)

8. Domain d1fcga2: 1fcg A:89-174 [21780]

Details for d1fcga2

PDB Entry: 1fcg, 2 Å

PDB Description: ectodomain of human fc gamma receptor, fcgriia

SCOP Domain Sequences for d1fcga2:

Sequence; same for both SEQRES and ATOM records:

>d1fcga2 b.1.1.4 (A:89-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa}
ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfshldptfsipqanhsh
sgdyhctgnigytlfsskpvtitvqv

Timeline for d1fcga2:

• d1fcga2 first appeared (with stable ids) in SCOP 1.55
  
• d1fcga2 appears in SCOP 1.59
  
• d1fcga2 appears in the current release, SCOPe 2.08