Lineage for d1fcga2 (1fcg A:89-174)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries) 
Domain d1fcga2: 1fcg A:89-174 [21780]
Details for d1fcga2
PDB Entry: 1fcg (more details), 2 Å
PDB Description: ectodomain of human fc gamma receptor, fcgriia
PDB Compounds: (A:) protein (fc receptor fc(gamma)riia)SCOPe Domain Sequences for d1fcga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcga2 b.1.1.4 (A:89-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa [TaxId: 9606]}
ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfshldptfsipqanhsh
sgdyhctgnigytlfsskpvtitvqv
SCOPe Domain Coordinates for d1fcga2:
Click to download the PDB-style file with coordinates for d1fcga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fcga2:
- d1fcga2 first appeared (with stable ids) in SCOP 1.55
- d1fcga2 appears in SCOPe 2.07
View in 3D
