Lineage for d1fcga2 (1fcg A:89-174)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2354818Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2354819Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)
  8. 2354821Domain d1fcga2: 1fcg A:89-174 [21780]

Details for d1fcga2

PDB Entry: 1fcg (more details), 2 Å

PDB Description: ectodomain of human fc gamma receptor, fcgriia
PDB Compounds: (A:) protein (fc receptor fc(gamma)riia)

SCOPe Domain Sequences for d1fcga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcga2 b.1.1.4 (A:89-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa [TaxId: 9606]}
ewlvlqtphlefqegetimlrchswkdkplvkvtffqngksqkfshldptfsipqanhsh
sgdyhctgnigytlfsskpvtitvqv

SCOPe Domain Coordinates for d1fcga2:

Click to download the PDB-style file with coordinates for d1fcga2.
(The format of our PDB-style files is described here.)

Timeline for d1fcga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcga1