Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries) |
Domain d3vf6a1: 3vf6 A:2-218 [217793] automated match to d1bdga1 complexed with 0h6, glc, na |
PDB Entry: 3vf6 (more details), 1.86 Å
SCOPe Domain Sequences for d3vf6a1:
Sequence, based on SEQRES records: (download)
>d3vf6a1 c.55.1.0 (A:2-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} hhenlyfqgmkkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlpty vrstpegsevgdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaem lfdyisecisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnv vgllrdaikrrgdfemdvvamvndtvatmiscyyedh
>d3vf6a1 c.55.1.0 (A:2-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} hhenlyfqgmkkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlpty vrstpegsevgdflsldlggtnfrvmlvkvgesvktkhqmysipedamtgtaemlfdyis ecisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrd aikrrgdfemdvvamvndtvatmiscyyedh
Timeline for d3vf6a1: