SCOPe 2.03: Domain d3veya2: 3vey A:219-461

Lineage for d3veya2 (3vey A:219-461)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Glucokinase [102479] (1 species)
   Hexokinase D

7. Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries)

8. Domain d3veya2: 3vey A:219-461 [217791]
   automated match to d1v4sa2
   complexed with 0h5, ags, glc, na

Details for d3veya2

PDB Entry: 3vey, 2.25 Å

PDB Description: glucokinase in complex with glucose and atpgs

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3veya2:

Sequence; same for both SEQRES and ATOM records:

>d3veya2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kac

Timeline for d3veya2:

• d3veya2 is new in SCOPe 2.03-stable
  
• d3veya2 appears in SCOPe 2.04
  
• d3veya2 appears in the current release, SCOPe 2.08