![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Glucokinase [102479] (1 species) Hexokinase D |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries) |
![]() | Domain d3veya2: 3vey A:219-461 [217791] Other proteins in same PDB: d3veya3 automated match to d1v4sa2 complexed with 0h5, ags, glc, na |
PDB Entry: 3vey (more details), 2.25 Å
SCOPe Domain Sequences for d3veya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3veya2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kac
Timeline for d3veya2: