Lineage for d1fcga1 (1fcg A:4-88)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753603Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753604Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)
  8. 2753605Domain d1fcga1: 1fcg A:4-88 [21779]

Details for d1fcga1

PDB Entry: 1fcg (more details), 2 Å

PDB Description: ectodomain of human fc gamma receptor, fcgriia
PDB Compounds: (A:) protein (fc receptor fc(gamma)riia)

SCOPe Domain Sequences for d1fcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcga1 b.1.1.4 (A:4-88) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa [TaxId: 9606]}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlf

SCOPe Domain Coordinates for d1fcga1:

Click to download the PDB-style file with coordinates for d1fcga1.
(The format of our PDB-style files is described here.)

Timeline for d1fcga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fcga2