| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein NT3 binding domain of trkC receptor [49194] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49195] (1 PDB entry) |
| Domain d1wwca_: 1wwc A: [21778] swapped N-terminal strand dimer |
PDB Entry: 1wwc (more details), 1.9 Å
SCOPe Domain Sequences for d1wwca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]}
tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis
egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde
Timeline for d1wwca_: