Lineage for d1wwca_ (1wwc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753878Protein NT3 binding domain of trkC receptor [49194] (1 species)
  7. 2753879Species Human (Homo sapiens) [TaxId:9606] [49195] (1 PDB entry)
  8. 2753880Domain d1wwca_: 1wwc A: [21778]
    swapped N-terminal strand dimer

Details for d1wwca_

PDB Entry: 1wwc (more details), 1.9 Å

PDB Description: nt3 binding domain of human trkc receptor
PDB Compounds: (A:) protein (nt-3 growth factor receptor trkc)

SCOPe Domain Sequences for d1wwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]}
tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis
egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde

SCOPe Domain Coordinates for d1wwca_:

Click to download the PDB-style file with coordinates for d1wwca_.
(The format of our PDB-style files is described here.)

Timeline for d1wwca_: