Lineage for d3vczc_ (3vcz C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959080Species Vibrio vulnificus [TaxId:216895] [226289] (1 PDB entry)
  8. 2959083Domain d3vczc_: 3vcz C: [217768]
    automated match to d1xrgb_
    complexed with ca, gol, mg

Details for d3vczc_

PDB Entry: 3vcz (more details), 1.8 Å

PDB Description: 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
PDB Compounds: (C:) Endoribonuclease L-PSP

SCOPe Domain Sequences for d3vczc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vczc_ d.79.1.0 (C:) automated matches {Vibrio vulnificus [TaxId: 216895]}
tkvlhtdsapaaigpyiqgvdlgnmvltsgqipvnpatgevpadiaaqarqsldnvkavv
easgltvgdivkmtvfvkdlndfgtvnevygnffdehnvahyparscvevarlpkdvgie
ieaiavr

SCOPe Domain Coordinates for d3vczc_:

Click to download the PDB-style file with coordinates for d3vczc_.
(The format of our PDB-style files is described here.)

Timeline for d3vczc_: