Lineage for d3vcra_ (3vcr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098745Species Oleispira antarctica [TaxId:188908] [226283] (2 PDB entries)
  8. 2098748Domain d3vcra_: 3vcr A: [217764]
    automated match to d1vlwb_
    complexed with pyr

Details for d3vcra_

PDB Entry: 3vcr (more details), 1.84 Å

PDB Description: Crystal structure of a putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase from Oleispira antarctica
PDB Compounds: (A:) putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase

SCOPe Domain Sequences for d3vcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vcra_ c.1.10.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
mtqldtwlantkplipvividdlvhaipmakalvaggvhllevtlrteaglaaisaikka
vpeaivgagtvctaddfqkaidagaqfivspgltpeliekakqvkldgqwqgvflpgvat
asevmiaaqagitqlkcfpasaiggakllkawsgpfpdiqfcptggiskdnykeylglpn
vicaggswltesklliegdwnevtrraseivklsdi

SCOPe Domain Coordinates for d3vcra_:

Click to download the PDB-style file with coordinates for d3vcra_.
(The format of our PDB-style files is described here.)

Timeline for d3vcra_: