SCOPe 2.06: Domain d3vcoa1: 3vco A:1-181

Lineage for d3vcoa1 (3vco A:1-181)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226613] (1 PDB entry)

8. Domain d3vcoa1: 3vco A:1-181 [217763]
   Other proteins in same PDB: d3vcoa2
   automated match to d1dhfa_
   complexed with so4

Details for d3vcoa1

PDB Entry: 3vco, 1.95 Å

PDB Description: schistosoma mansoni dihydrofolate reductase

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3vcoa1:

Sequence; same for both SEQRES and ATOM records:

>d3vcoa1 c.71.1.0 (A:1-181) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mrlnvvvavsenwgigkggglpwkikkdmeffktvttkahpglknavvmgrvtwesipes
fkplkdrinivvsstlshapsfvqvvpslnaaidllyneefssivdevfiiggyrlykea
lkqsiypvriycthilsevdcdtyfpkvdwdklkkvdlpdipadtftengftfkfcvydv
p

Timeline for d3vcoa1:

• d3vcoa1 first appeared in SCOPe 2.03, called d3vcoa_
  
• d3vcoa1 was called d3vcoa_ in SCOPe 2.05
  
• d3vcoa1 appears in SCOPe 2.07
  
• d3vcoa1 appears in the current release, SCOPe 2.08