![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226613] (1 PDB entry) |
![]() | Domain d3vcoa1: 3vco A:1-181 [217763] Other proteins in same PDB: d3vcoa2 automated match to d1dhfa_ complexed with so4 |
PDB Entry: 3vco (more details), 1.95 Å
SCOPe Domain Sequences for d3vcoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vcoa1 c.71.1.0 (A:1-181) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} mrlnvvvavsenwgigkggglpwkikkdmeffktvttkahpglknavvmgrvtwesipes fkplkdrinivvsstlshapsfvqvvpslnaaidllyneefssivdevfiiggyrlykea lkqsiypvriycthilsevdcdtyfpkvdwdklkkvdlpdipadtftengftfkfcvydv p
Timeline for d3vcoa1: