Lineage for d3vcoa1 (3vco A:1-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904133Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226613] (1 PDB entry)
  8. 2904134Domain d3vcoa1: 3vco A:1-181 [217763]
    Other proteins in same PDB: d3vcoa2
    automated match to d1dhfa_
    complexed with so4

Details for d3vcoa1

PDB Entry: 3vco (more details), 1.95 Å

PDB Description: schistosoma mansoni dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3vcoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vcoa1 c.71.1.0 (A:1-181) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mrlnvvvavsenwgigkggglpwkikkdmeffktvttkahpglknavvmgrvtwesipes
fkplkdrinivvsstlshapsfvqvvpslnaaidllyneefssivdevfiiggyrlykea
lkqsiypvriycthilsevdcdtyfpkvdwdklkkvdlpdipadtftengftfkfcvydv
p

SCOPe Domain Coordinates for d3vcoa1:

Click to download the PDB-style file with coordinates for d3vcoa1.
(The format of our PDB-style files is described here.)

Timeline for d3vcoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vcoa2