| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries) |
| Domain d1wway_: 1wwa Y: [21776] swapped N-terminal strand dimer |
PDB Entry: 1wwa (more details), 2.5 Å
SCOPe Domain Sequences for d1wway_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wway_ b.1.1.4 (Y:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
vqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaa
netvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
Timeline for d1wway_: