SCOPe 2.03: Domain d3vc3d_: 3vc3 D:

Lineage for d3vc3d_ (3vc3 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (18 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [226469] (2 PDB entries)

8. Domain d3vc3d_: 3vc3 D: [217759]
   automated match to d1oasa_
   complexed with c6p; mutant

Details for d3vc3d_

PDB Entry: 3vc3, 1.77 Å

PDB Description: Crystal structure of beta-cyanoalanine synthase K95A mutant in soybean

PDB Compounds: (D:) beta-cyanoalnine synthase

SCOPe Domain Sequences for d3vc3d_:

Sequence; same for both SEQRES and ATOM records:

>d3vc3d_ c.79.1.0 (D:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
astnikkhvsqligrtplvylnkvtegcgayvavkqemmqptasiadrpayamitdaeek
nlitpgkttlieptsgnmgismafmaamkgykmvltmpsytslerrvtmrafgaeliltd
pakgmggtvkkayellentpnahmlqqfsnpantqvhfettgpeiwedtngqvdifvmgi
gsggtvsgvgqylksknpnvkiygvepsesnvlnggkpgphhitgngvgfkpdildldvm
ekvlevssedavnmarvlalkeglmvgissgantvaalrlaqlpenkgklivtvhpsfge
rylssvlfqelrqeaenmqpvav

Timeline for d3vc3d_:

• d3vc3d_ is new in SCOPe 2.03-stable
  
• d3vc3d_ appears in SCOPe 2.04
  
• d3vc3d_ appears in the current release, SCOPe 2.08