Lineage for d3vc3b_ (3vc3 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2908045Species Soybean (Glycine max) [TaxId:3847] [226469] (2 PDB entries)
  8. 2908047Domain d3vc3b_: 3vc3 B: [217757]
    automated match to d1d6sa_
    complexed with c6p; mutant

Details for d3vc3b_

PDB Entry: 3vc3 (more details), 1.77 Å

PDB Description: Crystal structure of beta-cyanoalanine synthase K95A mutant in soybean
PDB Compounds: (B:) beta-cyanoalnine synthase

SCOPe Domain Sequences for d3vc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vc3b_ c.79.1.0 (B:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
stnikkhvsqligrtplvylnkvtegcgayvavkqemmqptasiadrpayamitdaeekn
litpgkttlieptsgnmgismafmaamkgykmvltmpsytslerrvtmrafgaeliltdp
akgmggtvkkayellentpnahmlqqfsnpantqvhfettgpeiwedtngqvdifvmgig
sggtvsgvgqylksknpnvkiygvepsesnvlnggkpgphhitgngvgfkpdildldvme
kvlevssedavnmarvlalkeglmvgissgantvaalrlaqlpenkgklivtvhpsfger
ylssvlfqelrqeaenmqpvav

SCOPe Domain Coordinates for d3vc3b_:

Click to download the PDB-style file with coordinates for d3vc3b_.
(The format of our PDB-style files is described here.)

Timeline for d3vc3b_: