Lineage for d1wwax_ (1wwa X:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries) 
Domain d1wwax_: 1wwa X: [21775]
swapped N-terminal strand dimer
Details for d1wwax_
PDB Entry: 1wwa (more details), 2.5 Å
PDB Description: ngf binding domain of human trka receptor
PDB Compounds: (X:) protein (nerve growth factor receptor trka)SCOPe Domain Sequences for d1wwax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwax_ b.1.1.4 (X:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefn
SCOPe Domain Coordinates for d1wwax_:
Click to download the PDB-style file with coordinates for d1wwax_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wwax_:
- d1wwax_ first appeared (with stable ids) in SCOP 1.55
- d1wwax_ appears in SCOPe 2.07
View in 3D
