Lineage for d3vbed_ (3vbe D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387421Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1387422Protein automated matches [190215] (18 species)
    not a true protein
  7. 1387541Species Soybean (Glycine max) [TaxId:3847] [226469] (2 PDB entries)
  8. 1387551Domain d3vbed_: 3vbe D: [217746]
    automated match to d1oasa_
    complexed with plp

Details for d3vbed_

PDB Entry: 3vbe (more details), 2.5 Å

PDB Description: Crystal structure of beta-cyanoalanine synthase in soybean
PDB Compounds: (D:) beta-cyanoalnine synthase

SCOPe Domain Sequences for d3vbed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbed_ c.79.1.0 (D:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
stnikkhvsqligrtplvylnkvtegcgayvavkqemmqptasikdrpayamitdaeekn
litpgkttlieptsgnmgismafmaamkgykmvltmpsytslerrvtmrafgaeliltdp
akgmggtvkkayellentpnahmlqqfsnpantqvhfettgpeiwedtngqvdifvmgig
sggtvsgvgqylksknpnvkiygvepsesnvlnggkpgphhitgngvgfkpdildldvme
kvlevssedavnmarvlalkeglmvgissgantvaalrlaqlpenkgklivtvhpsfger
ylssvlfqelrqeaenm

SCOPe Domain Coordinates for d3vbed_:

Click to download the PDB-style file with coordinates for d3vbed_.
(The format of our PDB-style files is described here.)

Timeline for d3vbed_: