Lineage for d3vbec1 (3vbe C:50-372)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140218Species Soybean (Glycine max) [TaxId:3847] [226469] (2 PDB entries)
  8. 2140227Domain d3vbec1: 3vbe C:50-372 [217745]
    Other proteins in same PDB: d3vbec2
    automated match to d1oasa_
    complexed with plp

Details for d3vbec1

PDB Entry: 3vbe (more details), 2.5 Å

PDB Description: Crystal structure of beta-cyanoalanine synthase in soybean
PDB Compounds: (C:) beta-cyanoalnine synthase

SCOPe Domain Sequences for d3vbec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbec1 c.79.1.0 (C:50-372) automated matches {Soybean (Glycine max) [TaxId: 3847]}
astnikkhvsqligrtplvylnkvtegcgayvavkqemmqptasikdrpayamitdaeek
nlitpgkttlieptsgnmgismafmaamkgykmvltmpsytslerrvtmrafgaeliltd
pakgmggtvkkayellentpnahmlqqfsnpantqvhfettgpeiwedtngqvdifvmgi
gsggtvsgvgqylksknpnvkiygvepsesnvlnggkpgphhitgngvgfkpdildldvm
ekvlevssedavnmarvlalkeglmvgissgantvaalrlaqlpenkgklivtvhpsfge
rylssvlfqelrqeaenmqpvav

SCOPe Domain Coordinates for d3vbec1:

Click to download the PDB-style file with coordinates for d3vbec1.
(The format of our PDB-style files is described here.)

Timeline for d3vbec1: