Lineage for d1wwwy_ (1www Y:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753711Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species)
  7. 2753712Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries)
  8. 2753714Domain d1wwwy_: 1www Y: [21774]
    Other proteins in same PDB: d1wwwv_, d1wwww_

Details for d1wwwy_

PDB Entry: 1www (more details), 2.2 Å

PDB Description: ngf in complex with domain 5 of the trka receptor
PDB Compounds: (Y:) protein (trka receptor)

SCOPe Domain Sequences for d1wwwy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwwy_ b.1.1.4 (Y:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp

SCOPe Domain Coordinates for d1wwwy_:

Click to download the PDB-style file with coordinates for d1wwwy_.
(The format of our PDB-style files is described here.)

Timeline for d1wwwy_: