Lineage for d3v94g_ (3v94 G:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1286061Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1286062Protein automated matches [190983] (4 species)
    not a true protein
  7. 1286131Species Trypanosoma cruzi [TaxId:5693] [226313] (2 PDB entries)
  8. 1286146Domain d3v94g_: 3v94 G: [217719]
    automated match to d2chma1
    complexed with mg, wyq, zn

Details for d3v94g_

PDB Entry: 3v94 (more details), 2.33 Å

PDB Description: TcrPDEC1 catalytic domain in complex with inhibitor wyq16
PDB Compounds: (G:) Cyclic nucleotide specific phosphodiesterase

SCOPe Domain Sequences for d3v94g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v94g_ a.211.1.0 (G:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mistrrlppsivqdtilavvppkscaaigtdvdlrdwgfdtfevasrvpsvlqsvamhva
lawdffasqeeaqkwaflvaavennyrpnpyhnaihaadvlqgtfslvsaakplmehltp
leckaaafaalthdvchpgrtnaflaavqdpvsfkfsgkgtleqlhtatafellnvtefd
ftssmdnasflefknivshlightdmslhsetvakhgaklsaggfdctckedrlealsll
lhaadigassrgvaiarkwlvilqefadqaederrrglpvtpgfetpssveksqipfldf
fviptfdllhqlfpsieeplhnlrklrelyaaka

SCOPe Domain Coordinates for d3v94g_:

Click to download the PDB-style file with coordinates for d3v94g_.
(The format of our PDB-style files is described here.)

Timeline for d3v94g_: