Lineage for d1qsva_ (1qsv A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 protein domains)
  6. 2355100Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 2355101Species Human (Homo sapiens) [TaxId:9606] [49189] (6 PDB entries)
  8. 2355114Domain d1qsva_: 1qsv A: [21771]

Details for d1qsva_

PDB Entry: 1qsv (more details)

PDB Description: the vegf-binding domain of flt-1, 20 nmr structures
PDB Compounds: (A:) vascular endothelial growth factor receptor 1

SCOPe Domain Sequences for d1qsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsva_ b.1.1.4 (A:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
rkgfiisnatykeiglltceatvnghlyktnylthrqtnti

SCOPe Domain Coordinates for d1qsva_:

Click to download the PDB-style file with coordinates for d1qsva_.
(The format of our PDB-style files is described here.)

Timeline for d1qsva_: