![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:5693] [226313] (2 PDB entries) |
![]() | Domain d3v93c_: 3v93 C: [217707] automated match to d2chma1 complexed with mg, zn |
PDB Entry: 3v93 (more details), 2 Å
SCOPe Domain Sequences for d3v93c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v93c_ a.211.1.0 (C:) automated matches {Trypanosoma cruzi [TaxId: 5693]} trrlppsivqdtilavvppkscaaigtdvdlrdwgfdtfevasrvpsvlqsvamhvalaw dffasqeeaqkwaflvaavennyrpnpyhnaihaadvlqgtfslvsaakplmehltplec kaaafaalthdvchpgrtnaflaavqdpvsfkfsgkgtleqlhtatafellnvtefdfts smdnasflefknivshlightdmslhsetvakhgaklsaggfdctckedrlealslllha adigassrgvaiarkwlvilqefadqaederrrglpvtpgfetpssveksqipfldffvi ptfdllhqlfpsieeplhnlrklrelyaakagv
Timeline for d3v93c_: