Lineage for d1qtyu_ (1qty U:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454918Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 454919Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 454925Domain d1qtyu_: 1qty U: [21770]
    Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_
    complex with VEGF

Details for d1qtyu_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1qtyu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyu_ b.1.1.4 (U:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOP Domain Coordinates for d1qtyu_:

Click to download the PDB-style file with coordinates for d1qtyu_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyu_: