![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d3v7ma1: 3v7m A:236-339 [217692] automated match to d2ql1a1 complexed with gol, imd, zn |
PDB Entry: 3v7m (more details), 2.02 Å
SCOPe Domain Sequences for d3v7ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v7ma1 b.1.1.2 (A:236-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d3v7ma1: