Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Second domain of the Flt-1 receptor [49188] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries) |
Domain d1qtyt_: 1qty T: [21769] Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_ complex with VEGF |
PDB Entry: 1qty (more details), 2.7 Å
SCOPe Domain Sequences for d1qtyt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtyt_ b.1.1.4 (T:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg fiisnatykeiglltceatvnghlyktnylthrq
Timeline for d1qtyt_: