SCOPe 2.08: Domain d3v6ff2: 3v6f F:115-219

Lineage for d3v6ff2 (3v6f F:115-219)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3v6ff2: 3v6f F:115-219 [217685]
Other proteins in same PDB: d3v6fa_, d3v6fb1, d3v6fc_, d3v6fd1, d3v6fe_, d3v6ff1, d3v6fh_, d3v6fl1
automated match to d2fd6l2

Details for d3v6ff2

PDB Entry: 3v6f (more details), 2.52 Å

PDB Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound

PDB Compounds: (F:) Fab e6 Light Chain

SCOPe Domain Sequences for d3v6ff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v6ff2 b.1.1.2 (F:115-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d3v6ff2:

Click to download the PDB-style file with coordinates for d3v6ff2.
(The format of our PDB-style files is described here.)

Timeline for d3v6ff2: