Lineage for d3v6ff1 (3v6f F:1-114)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297017Domain d3v6ff1: 3v6f F:1-114 [217684]
    Other proteins in same PDB: d3v6fb2, d3v6fd2, d3v6ff2, d3v6fl2
    automated match to d2fatl1

Details for d3v6ff1

PDB Entry: 3v6f (more details), 2.52 Å

PDB Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound
PDB Compounds: (F:) Fab e6 Light Chain

SCOPe Domain Sequences for d3v6ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v6ff1 b.1.1.0 (F:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleik

SCOPe Domain Coordinates for d3v6ff1:

Click to download the PDB-style file with coordinates for d3v6ff1.
(The format of our PDB-style files is described here.)

Timeline for d3v6ff1: