Lineage for d3v6fd2 (3v6f D:115-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752604Domain d3v6fd2: 3v6f D:115-219 [217683]
    Other proteins in same PDB: d3v6fa_, d3v6fb1, d3v6fc_, d3v6fd1, d3v6fe_, d3v6ff1, d3v6fh_, d3v6fl1
    automated match to d2fd6l2

Details for d3v6fd2

PDB Entry: 3v6f (more details), 2.52 Å

PDB Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound
PDB Compounds: (D:) Fab e6 Light Chain

SCOPe Domain Sequences for d3v6fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v6fd2 b.1.1.2 (D:115-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d3v6fd2:

Click to download the PDB-style file with coordinates for d3v6fd2.
(The format of our PDB-style files is described here.)

Timeline for d3v6fd2: