![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) ![]() |
![]() | Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
![]() | Protein automated matches [194480] (7 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:592021] [226327] (1 PDB entry) |
![]() | Domain d3v5ob1: 3v5o B:3-274 [217672] Other proteins in same PDB: d3v5oa2, d3v5ob2 automated match to d1tx2a_ complexed with so4 |
PDB Entry: 3v5o (more details), 2.5 Å
SCOPe Domain Sequences for d3v5ob1:
Sequence, based on SEQRES records: (download)
>d3v5ob1 c.1.21.1 (B:3-274) automated matches {Bacillus anthracis [TaxId: 592021]} wdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiidi ggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindi wgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdenii lnpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatv clgiekgcefvrvhdvkemsrmakmmdamigk
>d3v5ob1 c.1.21.1 (B:3-274) automated matches {Bacillus anthracis [TaxId: 592021]} wdydlrcgeytlnlnektlimgilnvtpdggsynevdaavrhakemrdegahiidigsve eeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaah ydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniilnpgigfaktpeqnl eamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhd vkemsrmakmmdamigk
Timeline for d3v5ob1: