Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein automated matches [194480] (3 species) not a true protein |
Species Bacillus anthracis [TaxId:592021] [226327] (1 PDB entry) |
Domain d3v5oa_: 3v5o A: [217671] automated match to d1tx2a_ complexed with so4 |
PDB Entry: 3v5o (more details), 2.5 Å
SCOPe Domain Sequences for d3v5oa_:
Sequence, based on SEQRES records: (download)
>d3v5oa_ c.1.21.1 (A:) automated matches {Bacillus anthracis [TaxId: 592021]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni ilnpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat vclgiekgcefvrvhdvkemsrmakmmdamigk
>d3v5oa_ c.1.21.1 (A:) automated matches {Bacillus anthracis [TaxId: 592021]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid igsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniilnpgigfakt peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef vrvhdvkemsrmakmmdamigk
Timeline for d3v5oa_: