Lineage for d3v5oa_ (3v5o A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425526Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2425527Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2425632Protein automated matches [194480] (7 species)
    not a true protein
  7. 2425633Species Bacillus anthracis [TaxId:592021] [226327] (1 PDB entry)
  8. 2425634Domain d3v5oa_: 3v5o A: [217671]
    automated match to d1tx2a_
    complexed with so4

Details for d3v5oa_

PDB Entry: 3v5o (more details), 2.5 Å

PDB Description: structural and mechanistic studies of catalysis and sulfa drug resistance in dihydropteroate synthase
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d3v5oa_:

Sequence, based on SEQRES records: (download)

>d3v5oa_ c.1.21.1 (A:) automated matches {Bacillus anthracis [TaxId: 592021]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ilnpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Sequence, based on observed residues (ATOM records): (download)

>d3v5oa_ c.1.21.1 (A:) automated matches {Bacillus anthracis [TaxId: 592021]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
igsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia
evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniilnpgigfakt
peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef
vrvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d3v5oa_:

Click to download the PDB-style file with coordinates for d3v5oa_.
(The format of our PDB-style files is described here.)

Timeline for d3v5oa_: