Lineage for d1qtyx_ (1qty X:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109354Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1109668Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 1109669Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 1109676Domain d1qtyx_: 1qty X: [21767]
    Other proteins in same PDB: d1qtyr_, d1qtys_, d1qtyv_, d1qtyw_
    complex with VEGF

Details for d1qtyx_

PDB Entry: 1qty (more details), 2.7 Å

PDB Description: vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
PDB Compounds: (X:) fms-like tyrosine kinase 1

SCOPe Domain Sequences for d1qtyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtyx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOPe Domain Coordinates for d1qtyx_:

Click to download the PDB-style file with coordinates for d1qtyx_.
(The format of our PDB-style files is described here.)

Timeline for d1qtyx_: