Lineage for d3v57c_ (3v57 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689278Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (5 PDB entries)
  8. 2689281Domain d3v57c_: 3v57 C: [217669]
    automated match to d3v58c_
    complexed with peb, so4

Details for d3v57c_

PDB Entry: 3v57 (more details), 1.7 Å

PDB Description: Crystal Structure of the B-phycoerythrin from the red algae Porphyridium Cruentum at pH8
PDB Compounds: (C:) Phycoerythrin alpha subunit

SCOPe Domain Sequences for d3v57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v57c_ a.1.1.3 (C:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals

SCOPe Domain Coordinates for d3v57c_:

Click to download the PDB-style file with coordinates for d3v57c_.
(The format of our PDB-style files is described here.)

Timeline for d3v57c_: