![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [226277] (1 PDB entry) |
![]() | Domain d3v4zb2: 3v4z B:97-306 [217666] Other proteins in same PDB: d3v4za1, d3v4zb1 automated match to d1iova2 complexed with peg, pge |
PDB Entry: 3v4z (more details), 2.69 Å
SCOPe Domain Sequences for d3v4zb2:
Sequence, based on SEQRES records: (download)
>d3v4zb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 214092]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg mtshslvpmaarqyglsfsqlvarilmlad
>d3v4zb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 214092]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshgmskvdhas elqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqpptqyfcpsglsdeseq qlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfs qlvarilmlad
Timeline for d3v4zb2: