| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
| Species Enterococcus faecalis [TaxId:1351] [419510] (4 PDB entries) |
| Domain d3v4xd1: 3v4x D:1-167 [217661] Other proteins in same PDB: d3v4xa2, d3v4xa3, d3v4xb2, d3v4xb3, d3v4xc2, d3v4xc3, d3v4xd2, d3v4xd3 automated match to d1tvza1 complexed with f24 |
PDB Entry: 3v4x (more details), 1.95 Å
SCOPe Domain Sequences for d3v4xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4xd1 c.95.1.2 (D:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvssepr
Timeline for d3v4xd1: