Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species) most similar to FabH |
Species Enterococcus faecalis [TaxId:1351] [225034] (4 PDB entries) |
Domain d3v4xc2: 3v4x C:168-383 [217660] Other proteins in same PDB: d3v4xa3, d3v4xb3, d3v4xc3, d3v4xd3 automated match to d1xpma2 complexed with f24 |
PDB Entry: 3v4x (more details), 1.95 Å
SCOPe Domain Sequences for d3v4xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4xc2 c.95.1.2 (C:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Enterococcus faecalis [TaxId: 1351]} ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey eamfaetldtdidqtledelkysisainntvrsyrn
Timeline for d3v4xc2: