Lineage for d1flty_ (1flt Y:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295686Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 1295687Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 1295689Domain d1flty_: 1flt Y: [21766]
    Other proteins in same PDB: d1fltv_, d1fltw_

Details for d1flty_

PDB Entry: 1flt (more details), 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor
PDB Compounds: (Y:) fms-like tyrosine kinase 1

SCOPe Domain Sequences for d1flty_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flty_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

SCOPe Domain Coordinates for d1flty_:

Click to download the PDB-style file with coordinates for d1flty_.
(The format of our PDB-style files is described here.)

Timeline for d1flty_: