SCOP 1.59: Domain d1flty_: 1flt Y:

Lineage for d1flty_ (1flt Y:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein Second domain of the Flt-1 receptor [49188] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries)

8. Domain d1flty_: 1flt Y: [21766]
   Other proteins in same PDB: d1fltv_, d1fltw_

Details for d1flty_

PDB Entry: 1flt, 1.7 Å

PDB Description: vegf in complex with domain 2 of the flt-1 receptor

SCOP Domain Sequences for d1flty_:

Sequence; same for both SEQRES and ATOM records:

>d1flty_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrq

Timeline for d1flty_:

• d1flty_ first appeared (with stable ids) in SCOP 1.55
  
• d1flty_ appears in SCOP 1.57
  
• d1flty_ appears in SCOP 1.61
  
• d1flty_ appears in the current release, SCOPe 2.08