![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Second domain of the Flt-1 receptor [49188] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49189] (6 PDB entries) |
![]() | Domain d1flty_: 1flt Y: [21766] Other proteins in same PDB: d1fltv_, d1fltw_ |
PDB Entry: 1flt (more details), 1.7 Å
SCOPe Domain Sequences for d1flty_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flty_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg fiisnatykeiglltceatvnghlyktnylthrq
Timeline for d1flty_: