Lineage for d3v4xc1 (3v4x C:1-167)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524268Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species)
    most similar to FabH
  7. 2524269Species Enterococcus faecalis [TaxId:1351] [225034] (4 PDB entries)
  8. 2524286Domain d3v4xc1: 3v4x C:1-167 [217659]
    Other proteins in same PDB: d3v4xa3, d3v4xb3, d3v4xc3, d3v4xd3
    automated match to d1tvza1
    complexed with f24

Details for d3v4xc1

PDB Entry: 3v4x (more details), 1.95 Å

PDB Description: The Biochemical and Structural Basis for Inhibition of Enterococcus faecalis HMG-CoA Synthase, mvaS, by Hymeglusin
PDB Compounds: (C:) HMG-CoA synthase

SCOPe Domain Sequences for d3v4xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4xc1 c.95.1.2 (C:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Enterococcus faecalis [TaxId: 1351]}
mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvssepr

SCOPe Domain Coordinates for d3v4xc1:

Click to download the PDB-style file with coordinates for d3v4xc1.
(The format of our PDB-style files is described here.)

Timeline for d3v4xc1: