SCOPe 2.08: Domain d3v4xb2: 3v4x B:168-383

Lineage for d3v4xb2 (3v4x B:168-383)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species)
   most similar to FabH

7. Species Enterococcus faecalis [TaxId:1351] [419511] (4 PDB entries)

8. Domain d3v4xb2: 3v4x B:168-383 [217658]
   Other proteins in same PDB: d3v4xa1, d3v4xa3, d3v4xb1, d3v4xb3, d3v4xc1, d3v4xc3, d3v4xd1, d3v4xd3
   automated match to d1xpma2
   complexed with f24
   has additional subdomain(s) that are not in the common domain

Details for d3v4xb2

PDB Entry: 3v4x, 1.95 Å

PDB Description: The Biochemical and Structural Basis for Inhibition of Enterococcus faecalis HMG-CoA Synthase, mvaS, by Hymeglusin

PDB Compounds: (B:) HMG-CoA synthase

SCOPe Domain Sequences for d3v4xb2:

Sequence; same for both SEQRES and ATOM records:

>d3v4xb2 c.95.1.2 (B:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn

Timeline for d3v4xb2:

• d3v4xb2 first appeared in SCOPe 2.03
  
• d3v4xb2 appears in SCOPe 2.07